1. 2 years ago 
    Blood Energy Potion is a $6 energy drink (available January 2010) that was made to look — and have the same nutritional value — of real blood. That’s pretty gross. “The fruit punch flavor packs 4 hours of energy along with iron, protein, and electrolytes. Not only does Blood Energy Potion have a similar nutritional makeup to real blood, but it has the same color, look, and consistency of blood. Get real blood nutrients without that real blood taste! The re-sealable transfusion bag style pouch provides the convenient delivery of fluids for vampires and humans alike! Contains no real blood, just synthetic! “ Pfft, forget synthetic blood. I drink the real deal. ISN’T THAT RIGHT, MY FALLEN ENEMIES?! Say, none of you had AIDS, right?

    Blood Energy Potion is a $6 energy drink (available January 2010) that was made to look — and have the same nutritional value — of real blood. That’s pretty gross.

    “The fruit punch flavor packs 4 hours of energy along with iron, protein, and electrolytes. Not only does Blood Energy Potion have a similar nutritional makeup to real blood, but it has the same color, look, and consistency of blood. Get real blood nutrients without that real blood taste! The re-sealable transfusion bag style pouch provides the convenient delivery of fluids for vampires and humans alike! Contains no real blood, just synthetic! “

    Pfft, forget synthetic blood. I drink the real deal. ISN’T THAT RIGHT, MY FALLEN ENEMIES?! Say, none of you had AIDS, right?

     

  2. Notes

avatar_128
 
 

A blog about things I find funny, thought provoking, all around awesome...and shit like that.

Blogs I read:

Something Intellectual

Things Not To Ask a Cop

Gamedians

Look How Fucking Bad I Parked

Jake and Amir

That Jerk Dan

Feel free to drop me a line at roflopogusl33t@gmail.com

 

BlogWithIntegrity.com
 
 

Following

tinycooperfunnyordiepiercedflamingobenwayward-swagabondthedailywhatblackdutchessthetartgwanwoothatjerkdanblondesnotbombsstaffitsalwayssunnyjakeandamirsweetfemininityacecalhounlhbipthatssosketchfmylifeemergencyandiiamfriendswithslutsgamediansibearfalsewitness
 

Tumblr